>4wf9_Q mol:protein length:91  50S ribosomal protein L23
MEARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYK
PKKKRMGRYQGYTNKRRKAIVTLKEGSIDLFN