>4wf9_S mol:protein length:217  50S ribosomal protein L25
MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNG
VIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEG
GVVEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIENDSAESVVT
VVAPTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE