>4wf9_T mol:protein length:94  50S ribosomal protein L27
MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENV
GRGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE