>4wfh_A mol:protein length:299  Potassium channel subfamily K member 4
MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQ
QAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGS
AFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIG
HIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTL
TTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTSNSLE
VLFQ