>4wfh_E mol:protein length:217  ANTI-TRAAK ANTIBODY 13E9 FAB FRAGMENT HEAVY CHAIN
EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTT
YNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAK
TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD