>4wfn_3 mol:protein length:65  50S ribosomal protein L35
MPKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMK
LMLPRG