>4wfn_H mol:protein length:134  50S ribosomal protein L14
MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDIIVASVKDAA
PRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINNQGEPRGTRVFGPVAREL
RDRRFMKIVSLAPEVL