>4wfn_U mol:protein length:81  50S ribosomal protein L28
MSRECYLTGKKNLVVNSVIRRGKARADGGVGRKTTGITKRVQRANLHKKAIRENGQVKT
VWLSANALRTLSKGPYKGIELI