>4wfn_V mol:protein length:67  50S ribosomal protein L29
MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAE
LARKGEQQ