>4wfn_W mol:protein length:55  50S ribosomal protein L30
MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHLLEVQE