>4x86_A mol:protein length:58  Ubiquitin-like protein 4A
GPLGSVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEV