>4x86_B mol:protein length:81  Large proline-rich protein BAG6
GPLGSAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQ
LRSDIQKRLQEDPNYSPQRFPN