>4xih_B mol:protein length:153  AhpC/TSA family protein
HMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPE
FENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANAG
TFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT