>4xq2_G mol:protein length:384  CalE6
SNAMSGMRFGTRLVHGGRRPSAGTGDVVPPIHVSTTYERRAQDEPRYFYGRGENPTREE
LEECLAGLERAPFATVFSSGQAAAATLLSLVRPGQCVVSTDDVYAGTDGLFDLAARQGV
RVRYADLTTPEGIAAALAEPDLALVWIETPTNPLLTVVDVAEVSRRAHERGARVVVDNT
FASPVLQQPLALGADVSLYSTTKSIAGHADVLGGALVYRDADLHAAVRAYRTTAGNVPG
ALDCFLVRRGLHTLSLRVHRQVATARVLVERLRASPVVGAVHYPGLPEHPQHAVVKAQM
SAPGAIVSFDYLGGPAERLLDRFTLFTCGVSLGGVHSLVECPALMTHRPLSAEARARRG
IGESLIRLSVGIEDPQDLAEDLSRALAGGT