>4xrs_A mol:protein length:58  Homeobox protein Meis1
FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMID