>4xxl_A mol:protein length:125  Cytochrome c class I
MTRQAYSSMLLSTAAALTLAFSLNASAAVDVDAAKSLARENNCFKCHGVDKEKDGPSYK
KVAEKYRGKADAEAKLIHHVTSGEKAKFPDGHEEEHKNINGKASPEAIKNLVDWILSLW
SHPQFEK
>4xxl_A mol:protein length:125  Cytochrome c class I
MTRQAYSSMLLSTAAALTLAFSLNASAAVDVDAAKSLARENNCFKCHGVDKEKDGPSYK
KVAEKYRGKADAEAKLIHHVTSGEKAKFPDGHEEEHKNINGKASPEAIKNLVDWILSLW
SHPQFEK