>4y05_A mol:protein length:387  Kinesin-like protein KIF2C
MGRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQE
LAKKEIDVISIPSKCLLLVHEKVDYLENQAFCFDFAFDETASNEVVYRFTAAPLVQTIF
EGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASADVFLLKNQPCYRKLGLE
VYVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSAC
RTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSADRQTRMEGA
EINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIATISPGISSCE
YTLNTLRYADRVKELSPHSGPSGEQLEHHHHHH
>4y05_A mol:protein length:387  Kinesin-like protein KIF2C
MGRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQE
LAKKEIDVISIPSKCLLLVHEKVDYLENQAFCFDFAFDETASNEVVYRFTAAPLVQTIF
EGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASADVFLLKNQPCYRKLGLE
VYVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSAC
RTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSADRQTRMEGA
EINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIATISPGISSCE
YTLNTLRYADRVKELSPHSGPSGEQLEHHHHHH