>4y0f_A mol:protein length:103  TAR DNA-binding protein 43
MRGSHHHHHHGSQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGF
GFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSR