>4y5o_A mol:protein length:98  Malcavernin
GSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQ
LYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRG