>4y5o_B mol:protein length:126  Mitogen-activated protein kinase kinase kinase 3
GSMDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRI
IAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSL
RILLLSQD