>4yc5_A mol:protein length:235  beta1
MGSSHHHHHHSSGLVPRGSHMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSY
ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQ
EANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANL
EQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG
>4yc5_A mol:protein length:235  beta1
MGSSHHHHHHSSGLVPRGSHMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSY
ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQ
EANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANL
EQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG