>4yxh_L mol:protein length:213  POM1 FAB LIGHT CHAIN
DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIP
SRFSGSGSGTDFTLSINSVESEDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIF
PPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSS
TLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE