>4z2c_D mol:protein length:269  DNA gyrase subunit B
MGHHHHHHHHHHSSGHIDDDDKHMKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAG
GSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKAR
YQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQ
PGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDA
AEADKIFDMLMGDRVEPRREFIEENAVYSTLDV