>4z7z_D mol:na length:28  DNA (28-MER)
AGCTGTCCATCGCTCAXGTACAGAGCTG
>4z7z_A mol:protein length:204  G/T mismatch-specific thymine DNA glycosylase
GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCL
FMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKY
QPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPR
AQDKVHYYIKLKDLRDQLKGIERNMDV
>4z7z_D mol:na length:28  DNA (28-MER)
AGCTGTCCATCGCTCAXGTACAGAGCTG
>4z7z_C mol:na length:28  DNA (28-MER)
CAGCTCTGTACGTGAGCGATGGACAGCT