>4zc3_A mol:protein length:68  Terminase small subunit
MKEPKLSPKQERFIEEYFINDMNATKAAIAAGYSKNSASAIGAENLQKPAIRARIDARL
KEINEKKIL