>4zdr_A mol:protein length:266  14-3-3 protein zeta/delta,GGSGGS linker,Serine/threonine-protein kinase STK11
MSYYHHHHHHLESTSLYKKAGLMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELS
NEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICND
VLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEI
SKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDS
TLIMQLLRDNLTLWTSGGSGGSRSMEVVPY