>4zdv_A mol:protein length:132  Microtubule-associated proteins 1A/1B light chain 3A
GPEEGDDFELLDGPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVL
DKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDED
GFLYMVYASQETFG