>4zin_B mol:protein length:219  MCherry fluorescent protein
AIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQ
FMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVK
LRGTNFPSDGPVMQKKTMGXEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYK
AKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTG