>5a15_E mol:protein length:120  BTB/POZ DOMAIN-CONTAINING PROTEIN KCTD16
SMGSAVPNSFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGR
FFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSP
DE