>5a24_A mol:protein length:222  DIONAIN-1
VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTN
GNDKGCNGGTPDGAFQYVVNNQGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDV
PANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNTNLDHAVTVVGYGTDPNS
GNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA
>5a24_A mol:protein length:222  DIONAIN-1
VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTN
GNDKGCNGGTPDGAFQYVVNNQGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDV
PANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNTNLDHAVTVVGYGTDPNS
GNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA