>5a31_E mol:protein length:110  ANAPHASE-PROMOTING COMPLEX SUBUNIT 16
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVF
SYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG