>5a31_G mol:protein length:85  ANAPHASE-PROMOTING COMPLEX SUBUNIT CDC26
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQ
MINDRIGYKPQPKPNNRSSQFGSLEF