>5a31_O mol:protein length:755  ANAPHASE-PROMOTING COMPLEX SUBUNIT 5
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLSEMSRTGEGAVSLVERRR
LNQQLLPLLQGPDITVSKLLKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDS
FSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQSDENKTVEDADMEL
TSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASL
QKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEG
YGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKR
SDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHS
LSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCH
LAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSL
VTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAEL
YWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIE
PILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKE
RIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL