>5a63_D mol:protein length:101  Gamma-secretase subunit PEN-2
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWR
SAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP