>5abt_A mol:protein length:253  1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO) METHYLIDENE AMINO] IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
MIIPALNLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAK
RQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAMKSPDVVKGWFER
FGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISRAG
TLAGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVK
EAIQCWQNVKGHHHHHH