>5aim_B mol:protein length:100  TRANSCRIPTION FACTOR TAU 138 KDA SUBUNIT
GAMASARSLRSLQRQRAILKVMNTIGGVAYLREQFYESVSKYMGSTTTLDKKTVRGDVD
LMVESEKLGARTEPVSGRKIIFLPTVGEDAIQRYILKEKDS