>5aj0_AI mol:protein length:214  60S ribosomal protein L10
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQ
LSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGA
FGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFN
ADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKWRALHS