>5aj0_Aq mol:protein length:165  60S ribosomal protein L12
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRIT
VKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRH
RSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS