>5aj0_Bf mol:protein length:156  Ubiquitin-40S ribosomal protein S27a
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY
NIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLR
RECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK