>5anc_A mol:protein length:398  60S RIBOSOMAL PROTEIN L3
MSHRKFEAPRHGNLGFRPRKRAARHQGKVKSFPKDDRTQKVHLTAFMGYKAGMTHVVRD
LEKPGSKMHKKEIVEAVTIIECPPMYIVGLVGYVETAQGLKTYKTVWAQHLSDNFRRRL
YKNWYKSKSKKAFTKYVKQYETEEGKKSIEASLQAIKKRCSVVRVIAHTQVHKLKLTQK
KAHVLEIQVNGGSIVEKVNFAVANFEKTVNVTGVFAENELIDVIGVTKGKGFNGVIKRW
GVRKLPRKTHKGLRKVACIGAWHPSRVSTTVPRAGQLGYHHRVERNKKIYRIGQAQPED
GKQISTGKTEFDLTEKTINPMGGFAHYGMVKHEFLMLKGCVAGPRKRALTLRKSITTQT
GRAALEKITLKFIDTSSKFGHGLHQTAEDKTKYFGVKKSRSTKA