>5anc_C mol:protein length:205  60S ACIDIC RIBOSOMAL PROTEIN P0
MSGAGSKRKNVFIEKATKLFTTYDKMIVAEADFVGSSQLQKIRKSIRGIGAVLMGKKTM
IRKVIRDLADSKPELDALNTYLKQNTCIIFCKDNIAEVKRVINTQRVGAPAKAGVFAPN
DVIIPAGPTGMEPTQTSFLQDLKIATKINRGQIDIVNEVHIIKTGQKVGASEATLLQKL
NIKPFTYGLEPKIIYDAGACYSPSISEE