>5anc_G mol:protein length:69  60S RIBOSOMAL PROTEIN L24
MKTSLCNYSEFKIYPARGMKFVRGDSKVFHFINTKVESLFFRKINPRDIRWSMVYRRIY
KNTTTDVSAK