>5b6q_B mol:protein length:76  Soluble cytochrome cA
QEGKAVYDKACHICHSMGVAGAPKAHDAAAWEPRIAQGLDTLVSTVKTGKGAMPPGGMC
TDCTDEDYKSAIEYMSK
>5b6q_B mol:protein length:76  Soluble cytochrome cA
QEGKAVYDKACHICHSMGVAGAPKAHDAAAWEPRIAQGLDTLVSTVKTGKGAMPPGGMC
TDCTDEDYKSAIEYMSK
>5b6q_A mol:protein length:76  Soluble cytochrome cA
QEGKAVYDKACHICHSMGVAGAPKAHDAAAWEPRIAQGLDTLVSTVKTGKGAMPPGGMC
TDCTDEDYKSAIEYMSK