>5b82_A mol:protein length:191  Tll0287 protein
MVRIFLMALLMASLWIQGSPAPLASANPEELGKVVTAIEQLDQMRIGLASTLEGGTSEP
TLDTFKAVCAPVGKQAKEIAAANGWQVRQVALKYRNPNHAPRTALDVQALNQFDNNHHL
QAFWQTDKEGVHYFRRIDVQASCLACHGAKNRRPAFIQEKYPSDRAYGFRVGDLRGMYA
VTIPQIQQALQTSP