>5bng_A mol:protein length:60  Homeobox protein Meis2
FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ
S
>5bng_D mol:na length:10  DNA (5'-D(P*TP*GP*AP*CP*AP*GP*CP*TP*AP*A)-3')
TGACAGCTAA
>5bng_B mol:protein length:60  Homeobox protein Meis2
FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ
S
>5bng_M mol:na length:12  DNA (5'-D(P*TP*GP*AP*CP*AP*GP*CP*TP*AP*A-3')
TGACAGCTAACG
>5bng_D mol:na length:10  DNA (5'-D(P*TP*GP*AP*CP*AP*GP*CP*TP*AP*A)-3')
TGACAGCTAA
>5bng_C mol:na length:12  DNA (5'-D(P*AP*AP*TP*TP*AP*GP*CP*TP*GP*TP*CP*A)-3')
GATTAGCTGTCA
>5bng_L mol:na length:10  DNA (5'-D(P*TP*TP*AP*GP*CP*TP*GP*TP*CP*A)-3')
TTAGCTGTCA