>5c5a_B mol:protein length:92  E3 ubiquitin-protein ligase Mdm2
PASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCS
NDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
>5c5a_A mol:protein length:92  E3 ubiquitin-protein ligase Mdm2
PASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCS
NDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
>5c5a_B mol:protein length:92  E3 ubiquitin-protein ligase Mdm2
PASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCS
NDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN