>5cve_E mol:protein length:9  N-terminal peptide from Histone H2B
XPKTSGKAA
>5cve_A mol:protein length:243  N-terminal Xaa-Pro-Lys N-methyltransferase 1
MGSSHHHHHHSSGLVPRGSHMTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISS
IDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLV
QAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSL
RPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYH
VYSFALR
>5cve_D mol:protein length:9  N-terminal peptide from Histone H2B
XPKTSGKAA
>5cve_E mol:protein length:9  N-terminal peptide from Histone H2B
XPKTSGKAA
>5cve_B mol:protein length:243  N-terminal Xaa-Pro-Lys N-methyltransferase 1
MGSSHHHHHHSSGLVPRGSHMTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISS
IDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLV
QAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSL
RPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYH
VYSFALR