>5d0a_D mol:protein length:437  Epoxyqueuosine reductase
MASRGSHHHHHHGAGDRGPEFELGTRGSMNVYQLKEELIEYAKSIGVDKIGFTTADTFD
SLKDRLILQESLGYLSGFEEPDIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRT
ERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHEDIRTKSMVDTGELSDRAVAERAGI
GFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQ
LNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEI
AKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHFKDASALPELTELMHK
DPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGIELLKASGMTKQGL
SGSLEVDLQGDHGLSAWSHPQFEK