>5d4d_O mol:protein length:99  DNA-directed RNA polymerase subunit omega
MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPN
AVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVEREE