>5d9i_B mol:protein length:134  Large T antigen
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRH
NSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEE
SLPGGLKEHDFNPESS
>5d9i_X mol:na length:21  DNA (5'-D(*GP*AP*GP*GP*AP*GP*GP*CP*TP*TP*TP*TP*TP*TP*GP*GP*AP*GP*GP*CP*C)-3')
GAGGAGGCTTTTTTGGAGGCC
>5d9i_A mol:protein length:134  Large T antigen
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRH
NSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEE
SLPGGLKEHDFNPESS
>5d9i_Y mol:na length:23  DNA (5'-D(*AP*CP*TP*CP*CP*TP*CP*CP*GP*AP*AP*AP*AP*AP*AP*CP*CP*TP*CP*CP*GP*GP*A)-3')
ACTCCTCCGAAAAAACCTCCGGA
>5d9i_X mol:na length:21  DNA (5'-D(*GP*AP*GP*GP*AP*GP*GP*CP*TP*TP*TP*TP*TP*TP*GP*GP*AP*GP*GP*CP*C)-3')
GAGGAGGCTTTTTTGGAGGCC